GOLPH2 Rabbit monoclonal antibody

Size

POA

SKU:: A11538
Additional Names:: bA379P1.3|C9orf155|GOLPH2|GP73|HEL46|PSEC0257
Application:: ELISA, WB
Molecular Weight:: 73 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD
Uniprot:: Q8NBJ4
Synonyms:: bA379P1.3;C9orf155;epididymis luminal protein 46;Golgi membrane protein 1;golgi membrane protein GP73;golgi phosphoprotein 2;golgi protein, 73-kD;GOLPH2;GP73;HEL46;PSEC0257
Extra Details:: The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene.