A11538
GOLPH2 Rabbit monoclonal antibody

Size
POA
- SKU:
- A11538
- Additional Names:
- bA379P1.3|C9orf155|GOLPH2|GP73|HEL46|PSEC0257
- Application:
- ELISA, WB
- Molecular Weight:
- 73 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VEKEETNEIQVVNEEPQRDRLPQEPGREQVVEDRPVGGRGFGGAGELGQTPQVQAALSVSQENPEMEGPERDQLVIPDGQEEEQEAAGEGRNQQKLRGEDD
- Uniprot:
- Q8NBJ4
- Synonyms:
- bA379P1.3;C9orf155;epididymis luminal protein 46;Golgi membrane protein 1;golgi membrane protein GP73;golgi phosphoprotein 2;golgi protein, 73-kD;GOLPH2;GP73;HEL46;PSEC0257
- Extra Details:
- The Golgi complex plays a key role in the sorting and modification of proteins exported from the endoplasmic reticulum. The protein encoded by this gene is a type II Golgi transmembrane protein. It processes proteins synthesized in the rough endoplasmic reticulum and assists in the transport of protein cargo through the Golgi apparatus. The expression of this gene has been observed to be upregulated in response to viral infection. Alternatively spliced transcript variants encoding the same protein have been described for this gene.
- Shipping Conditions:
- Blue Ice

