CD27 Rabbit monoclonal antibody

Size

POA

SKU:: A11505
Additional Names:: CD27|S152|S152. LPFS2|T14|TNFRSF7|Tp55
Application:: ELISA, WB, IF
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MARPHPWWLCVLGTLVGLSATPAPKSCPERHYWAQGKLCCQMCEPGTFLVKDCDQHRKAAQCDPCIPGVSFSPDHHTRPHCESCRHCNSGLLVRNCTITA
Uniprot:: P26842
Synonyms:: CD27 antigen;CD27L receptor;S152;S152. LPFS2;T cell activation antigen S152;T-cell activation antigen CD27;T14;TNFRSF7;Tp55;Tumor necrosis factor receptor superfamily member 7;tumor necrosis factor receptor superfamily, member 7
Extra Details:: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is required for generation and long-term maintenance of T cell immunity. It binds to ligand CD70, and plays a key role in regulating B-cell activation and immunoglobulin synthesis. This receptor transduces signals that lead to the activation of NF-kappaB and MAPK8/JNK. Adaptor proteins TRAF2 and TRAF5 have been shown to mediate the signaling process of this receptor. CD27-binding protein (SIVA), a proapoptotic protein, can bind to this receptor and is thought to play an important role in the apoptosis induced by this receptor.