CELF1 Rabbit monoclonal antibody

Size

POA

SKU:: A1150
Additional Names:: BRUNOL2|CELF1|CUG-BP|CUGBP|CUGBP1|EDEN-BP|hNab50|NAB50|NAPOR
Application:: ELISA, WB, IP
Molecular Weight:: 52kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE
Uniprot:: Q92879
Synonyms:: 50 kDa nuclear polyadenylated RNA-binding protein;bruno-like 2;bruno-like protein 2;BRUNOL2;CUG RNA-binding protein;CUG triplet repeat RNA-binding protein 1;CUG-BP;CUG-BP- and ETR-3-like factor 1;CUGBP;CUGBP Elav-like family member 1;CUGBP1;deadenylation factor CUG-BP;EDEN-BP;EDEN-BP homolog;embryo deadenylation element binding protein;embryo deadenylation element-binding protein homolog;hNab50;NAB50;NAPOR;nuclear polyadenylated RNA-binding protein, 50-kD;RNA-binding protein BRUNOL-2
Extra Details:: Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. This gene may play a role in myotonic dystrophy type 1 (DM1) via interactions with the dystrophia myotonica-protein kinase (DMPK) gene. Alternative splicing results in multiple transcript variants encoding different isoforms.

Shipping Conditions:: Blue Ice