A11478
CES1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A11478
- Additional Names:
- ACAT|CE-1|CEH|CES1|CES2|hCE-1|HMSE|HMSE1|PCE-1|REH|SES1|TGH
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 63kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL
- Uniprot:
- P23141
- Synonyms:
- ACAT;acyl coenzyme A:cholesterol acyltransferase;Acyl-coenzyme A:cholesterol acyltransferase;brain carboxylesterase hBr1;Carboxylesterase 1;carboxylesterase 1 (monocyte/macrophage serine esterase 1);carboxylesterase 2 (liver);CE-1;CEH;CES2;cholesteryl ester hydrolase;cocaine carboxylesterase;egasyn;hCE-1;HMSE;HMSE1;human monocyte/macrophage serine esterase 1;liver carboxylesterase 1;methylumbelliferyl-acetate deacetylase 1;monocyte/macrophage serine esterase;PCE-1;REH;retinyl ester hydrolase;serine esterase 1;SES1;TGH;triacylglycerol hydrolase
- Extra Details:
- This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They may participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This enzyme is the major liver enzyme and functions in liver drug clearance. Mutations of this gene cause carboxylesterase 1 deficiency. Three transcript variants encoding three different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice