ATOH1 Rabbit monoclonal antibody

Size

POA

SKU:: A11477
Additional Names:: ATH1|ATOH1|bHLHa14|DFNA89|HATH1|MATH-1
Application:: ELISA, WB
Molecular Weight:: 45kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVD
Uniprot:: Q92858
Synonyms:: ATH1;atonal homolog 1;atonal homolog bHLH transcription factor 1;bHLHa14;class A basic helix-loop-helix protein 14;HATH1;helix-loop-helix protein hATH-1;MATH-1;protein atonal homolog 1
Extra Details:: Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in neuron differentiation; positive regulation of neuron differentiation; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including generation of neurons; inner ear morphogenesis; and positive regulation of inner ear auditory receptor cell differentiation. Predicted to be part of chromatin. Predicted to be active in nucleus.