A1145
TRADD Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1145
- Additional Names:
- 9130005N23Rik|TRADD
- Application:
- ELISA, WB
- Molecular Weight:
- 36kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
- Uniprot:
- Q15628
- Synonyms:
- Hs.89862;TNFR1-associated death domain protein;TNFRSF1A-associated via death domain;tumor necrosis factor receptor type 1 associated death domain protein;tumor necrosis factor receptor type 1-associated DEATH domain protein;tumor necrosis factor receptor-1-associated protein
- Extra Details:
- Predicted to enable death domain binding activity; identical protein binding activity; and signaling receptor binding activity. Involved in positive regulation of hair follicle development. Acts upstream of or within extrinsic apoptotic signaling pathway. Located in cytoplasm. Is expressed in adrenal gland; genitourinary system; liver; lung; and spleen. Orthologous to human TRADD (TNFRSF1A associated via death domain).
- Shipping Conditions:
- Blue Ice

