TRADD Rabbit polyclonal antibody

Size

£152.00

SKU:: A1145
Additional Names:: 9130005N23Rik|TRADD
Application:: ELISA, WB
Molecular Weight:: 36kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: AQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLLGLTDPNGGLA
Uniprot:: Q15628
Synonyms:: Hs.89862;TNFR1-associated death domain protein;TNFRSF1A-associated via death domain;tumor necrosis factor receptor type 1 associated death domain protein;tumor necrosis factor receptor type 1-associated DEATH domain protein;tumor necrosis factor receptor-1-associated protein
Extra Details:: Predicted to enable death domain binding activity; identical protein binding activity; and signaling receptor binding activity. Involved in positive regulation of hair follicle development. Acts upstream of or within extrinsic apoptotic signaling pathway. Located in cytoplasm. Is expressed in adrenal gland; genitourinary system; liver; lung; and spleen. Orthologous to human TRADD (TNFRSF1A associated via death domain).