A11444
GCLM Rabbit monoclonal antibody

Size
POA
- SKU:
- A11444
- Additional Names:
- GCLM|GLCLR
- Application:
- ELISA, WB
- Molecular Weight:
- 31kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
- Uniprot:
- P48507
- Synonyms:
- gamma-ECS regulatory subunit;gamma-glutamylcysteine synthetase regulatory subunit;GCS light chain;GLCLR;Glutamate--cysteine ligase modifier subunit;glutamate--cysteine ligase regulatory subunit;glutamate-cysteine ligase (gamma-glutamylcysteine synthetase), regulatory (30.8kD);glutamate-cysteine ligase modifier subunit delta2 alternative splicing;glutamate-cysteine ligase regulatory protein;GSC light chain
- Extra Details:
- Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase, is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. Gamma glutamylcysteine synthetase deficiency has been implicated in some forms of hemolytic anemia. Alternative splicing results in multiple transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice

