RAC2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1139
Additional Names:: EN-7|Gx|HSPC022|IMD73A|IMD73B|IMD73C|p21-Rac2|RAC2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 21 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRACSLL
Uniprot:: P15153
Synonyms:: EN-7;Gx;HSPC022;IMD73A;IMD73B;IMD73C;p21-Rac2;ras-related C3 botulinum toxin substrate 2;ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2);Ras-related C3 botulinum toxin substrate 3 (rho family, small GTP-binding protein Rac2);small G protein
Extra Details:: This gene encodes a member of the Ras superfamily of small guanosine triphosphate (GTP)-metabolizing proteins. The encoded protein localizes to the plasma membrane, where it regulates diverse processes, such as secretion, phagocytosis, and cell polarization. Activity of this protein is also involved in the generation of reactive oxygen species. Mutations in this gene are associated with neutrophil immunodeficiency syndrome. There is a pseudogene for this gene on chromosome 6.

Shipping Conditions:: Blue Ice