c-Jun Rabbit polyclonal antibody

Size

£152.00

SKU:: A11378
Additional Names:: AP-1|AP1|c-Jun|cJUN|p39
Application:: ELISA, WB
Molecular Weight:: 43kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLK
Uniprot:: P05412
Synonyms:: activator protein 1;AP-1;AP1;c-Jun;cJUN;enhancer-binding protein AP1;Jun activation domain binding protein;jun oncogene;p39;proto-oncogene c-Jun;proto-oncogene cJun;transcription factor AP-1;v-jun avian sarcoma virus 17 oncogene homolog;v-jun sarcoma virus 17 oncogene homolog
Extra Details:: This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.