A11339
DDX5 Rabbit monoclonal antibody

Size
POA
- SKU:
- A11339
- Additional Names:
- DDX5|G17P1|HLR1|HUMP68|p68
- Application:
- ELISA, WB, IHC-P, IF, ICC, IP
- Molecular Weight:
- 69kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEAN
- Uniprot:
- P17844
- Synonyms:
- ATP-dependent RNA helicase DDX5;DEAD (Asp-Glu-Ala-Asp) box helicase 5;DEAD (Asp-Glu-Ala-Asp) box polypeptide 5;DEAD box protein 5;DEAD box-5;DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 5 (RNA helicase, 68kD);G17P1;HLR1;HUMP68;p68;probable ATP-dependent RNA helicase DDX5;RNA helicase p68
- Extra Details:
- This gene encodes a member of the DEAD box family of RNA helicases that are involved in a variety of cellular processes as a result of its role as an adaptor molecule, promoting interactions with a large number of other factors. This protein is involved in pathways that include the alteration of RNA structures, plays a role as a coregulator of transcription, a regulator of splicing, and in the processing of small noncoding RNAs. Members of this family contain nine conserved motifs, including the conserved Asp-Glu-Ala-Asp (DEAD) motif, important to ATP binding and hydrolysis as well as RNA binding and unwinding activities. Dysregulation of this gene may play a role in cancer development. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice








