A11319
Caspase-3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A11319
- Additional Names:
- Caspase-3|CPP32|CPP32B|SCA-1
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 17kDa/19kDa/32kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- NSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSK
- Uniprot:
- P42574
- Synonyms:
- apopain;CASP-3;caspase 3, apoptosis-related cysteine peptidase;caspase 3, apoptosis-related cysteine protease;caspase-3;CPP-32;CPP32;CPP32B;cysteine protease CPP32;PARP cleavage protease;procaspase3;protein Yama;SCA-1;SREBP cleavage activity 1
- Extra Details:
- The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease.
- Shipping Conditions:
- Blue Ice





_WB_01.jpg)


