GC1q R/C1QBP Rabbit monoclonal antibody

Size

POA

SKU:: A11292
Additional Names:: COXPD33|GC1q R/C1QBP|gC1Q-R|GC1QBP|gC1qR|HABP1|p32|SF2AP32|SF2p32
Application:: ELISA, WB, IHC-P
Molecular Weight:: 31kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE
Uniprot:: Q07021
Synonyms:: ASF/SF2-associated protein p32;C1q globular domain-binding protein;complement component 1 Q subcomponent-binding protein, mitochondrial;complement component 1, q subcomponent binding protein;COXPD33;gC1Q-R;gC1q-R protein;GC1QBP;gC1qR;glycoprotein gC1qBP;HABP1;hyaluronan-binding protein 1;mitochondrial matrix protein p32;p32;p33;SF2AP32;SF2p32;splicing factor SF2-associated protein
Extra Details:: The human complement subcomponent C1q associates with C1r and C1s in order to yield the first component of the serum complement system. The protein encoded by this gene is known to bind to the globular heads of C1q molecules and inhibit C1 activation. This protein has also been identified as the p32 subunit of pre-mRNA splicing factor SF2, as well as a hyaluronic acid-binding protein.