Cardiac troponin T (TNNT2) Rabbit polyclonal antibody

Size

£152.00

SKU:: A1126
Additional Names:: Cardiac troponin T (TNNT2)|CMD1D|CMH2|CMPD2|cTnT|LVNC6|RCM3|TnTC
Application:: ELISA, WB, IHC-P, IF
Molecular Weight:: 40 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEEL
Uniprot:: P45379
Synonyms:: Cardiac muscle troponin T;cardiomyopathy, dilated 1D (autosomal dominant);cardiomyopathy, hypertrophic 2;CMD1D;CMH2;CMPD2;cTnT;LVNC6;RCM3;TnTC;troponin T type 2 (cardiac);troponin T, cardiac muscle;truncated cardiac troponin T
Extra Details:: This gene encodes the cardiac isoform of troponin T. The encoded protein is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy.