A11235
Annexin A2 Rabbit monoclonal antibody
Size
POA
- SKU:
- A11235
- Additional Names:
- Annexin A2|ANX2|ANX2L4|CAL1H|HEL-S-270|LIP2|LPC2|LPC2D|P36|PAP-IV
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 39kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNILTNRSNAQRQDIAFAYQRRTKKELASALKSALSGHLETVIL
- Uniprot:
- P07355
- Synonyms:
- annexin A2;annexin II;annexin-2;ANX2;ANX2L4;CAL1H;calpactin I heavy chain;calpactin I heavy polypeptide;calpactin-1 heavy chain;chromobindin 8;Chromobindin-8;epididymis secretory protein Li 270;epididymis secretory sperm binding protein;HEL-S-270;LIP2;lipocortin II;LPC2;LPC2D;P36;PAP-IV;placental anticoagulant protein IV;protein I
- Extra Details:
- This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. Annexin A2 expression has been found to correlate with resistance to treatment against various cancer forms.
- Shipping Conditions:
- Blue Ice