A11177
PI3 Kinase p85 alpha Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A11177
- Additional Names:
- AGM7|GRB1|IMD36|p85|p85-ALPHA|p85alpha|PI3 Kinase p85 alpha
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 85kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKL
- Uniprot:
- P27986
- Synonyms:
- AGM7;GRB1;IMD36;p85;p85-ALPHA;phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha;phosphatidylinositol 3-kinase regulatory subunit alpha;phosphatidylinositol 3-kinase-associated p-85 alpha;phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha);phosphoinositide-3-kinase regulatory subunit alpha;phosphoinositide-3-kinase, regulatory subunit 1 (alpha);PI3-kinase subunit p85-alpha;PI3K regulatory subunit alpha;ptdIns-3-kinase regulatory subunit alpha
- Extra Details:
- Phosphatidylinositol 3-kinase phosphorylates the inositol ring of phosphatidylinositol at the 3-prime position. The enzyme comprises a 110 kD catalytic subunit and a regulatory subunit of either 85, 55, or 50 kD. This gene encodes the 85 kD regulatory subunit. Phosphatidylinositol 3-kinase plays an important role in the metabolic actions of insulin, and a mutation in this gene has been associated with insulin resistance. Alternative splicing of this gene results in four transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice