ROCK1 Rabbit monoclonal antibody

Size

POA

SKU:: A11158
Additional Names:: P160ROCK|ROCK-I|ROCK1
Application:: ELISA, WB
Molecular Weight:: 158 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: STSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
Uniprot:: Q13464
Synonyms:: p160 ROCK-1;P160ROCK;renal carcinoma antigen NY-REN-35;rho-associated protein kinase 1;Rho-associated, coiled-coil-containing protein kinase 1;Rho-associated, coiled-coil-containing protein kinase I;ROCK-I
Extra Details:: This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets and lymphocytes by shuttling between the inactive GDP-bound form and the active GTP-bound form. Rho is also essential in cytokinesis and plays a role in transcriptional activation by serum response factor. This protein, a downstream effector of Rho, phosphorylates and activates LIM kinase, which in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. A pseudogene, related to this gene, is also located on chromosome 18.

Shipping Conditions:: Blue Ice