A11156
HSP27/HSPB1 Rabbit monoclonal antibody
Size
POA
- SKU:
- A11156
- Additional Names:
- CMT2F|HEL-S-102|HMN2B|HS.76067|Hsp25|HSP27|HSP27/HSPB1|HSP28|SRP27
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 27kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- DVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
- Uniprot:
- P04792
- Synonyms:
- 28 kDa heat shock protein;CMT2F;epididymis secretory protein Li 102;estrogen-regulated 24 kDa protein;heat shock 27 kDa protein;heat shock 27kD protein 1;heat shock 27kDa protein 1;heat shock protein beta-1;HEL-S-102;HMN2B;HS.76067;Hsp25;HSP27;HSP28;putative heat shock protein family B member 1 isoform;SRP27;stress-responsive protein 27
- Extra Details:
- This gene encodes a member of the small heat shock protein (HSP20) family of proteins. In response to environmental stress, the encoded protein translocates from the cytoplasm to the nucleus and functions as a molecular chaperone that promotes the correct folding of other proteins. This protein plays an important role in the differentiation of a wide variety of cell types. Expression of this gene is correlated with poor clinical outcome in multiple human cancers, and the encoded protein may promote cancer cell proliferation and metastasis, while protecting cancer cells from apoptosis. Mutations in this gene have been identified in human patients with Charcot-Marie-Tooth disease and distal hereditary motor neuropathy.
- Shipping Conditions:
- Blue Ice