IL-6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A11115
Additional Names:: BSF-2|BSF2|CDF|HGF|HSF|IFN-beta-2|IFNB2|IL-6|IL6
Application:: ELISA, WB
Molecular Weight:: 23kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Uniprot:: P05231
Synonyms:: B-cell differentiation factor;B-cell stimulatory factor 2;BSF-2;BSF2;CDF;CTL differentiation factor;HGF;HSF;hybridoma growth factor;IFN-beta-2;IFNB2;IL-6;interferon beta-2;interleukin BSF-2;interleukin-6
Extra Details:: This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2).

Shipping Conditions:: Blue Ice