A11115
IL-6 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A11115
- Additional Names:
- BSF-2|BSF2|CDF|HGF|HSF|IFN-beta-2|IFNB2|IL-6|IL6
- Application:
- ELISA, WB
- Molecular Weight:
- 23kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
- Uniprot:
- P05231
- Synonyms:
- B-cell differentiation factor;B-cell stimulatory factor 2;BSF-2;BSF2;CDF;CTL differentiation factor;HGF;HSF;hybridoma growth factor;IFN-beta-2;IFNB2;IL-6;interferon beta-2;interleukin BSF-2;interleukin-6
- Extra Details:
- This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2).
- Shipping Conditions:
- Blue Ice

_WB_01.jpg)