IL22RA1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10941
Additional Names:: CRF2-9|IL22R|IL22R1|IL22RA1
Application:: ELISA, WB
Molecular Weight:: 68kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYS
Uniprot:: Q8N6P7
Synonyms:: CRF2-9;cytokine receptor class-II member 9;cytokine receptor family 2 member 9;IL-22 receptor subunit alpha-1;IL-22R-alpha-1;IL-22RA1;IL22R;IL22R1;interleukin 22 receptor, alpha 1;interleukin-22 receptor subunit alpha-1;zcytoR11
Extra Details:: The protein encoded by this gene belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4), a subunit also shared by the receptor complex for interleukin 10 (IL10). This gene and interleukin 28 receptor, alpha (IL28RA) form a cytokine receptor gene cluster in the chromosomal region 1p36.