PP1 beta Rabbit polyclonal antibody

Size

£152.00

SKU:: A1088
Additional Names:: HEL-S-80p|MP|NSLH2|PP-1B|PP1 beta|PP1B|PP1beta|PP1c|PPP1beta|PPP1CD
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 30-35kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRPVTPPRTANPPKKR
Uniprot:: P62140
Synonyms:: epididymis secretory sperm binding protein Li 80p;HEL-S-80p;MP;myosin phosphatase;NSLH2;PP-1B;PP1B;PP1beta;PP1c;PPP1beta;PPP1CD;protein phosphatase 1-beta;protein phosphatase 1-delta;protein phosphatase 1, catalytic subunit, beta isozyme;serine/threonine-protein phosphatase PP1-beta catalytic subunit
Extra Details:: The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two alternatively spliced transcript variants encoding distinct isoforms have been observed.