[KD Validated] MTMR3 Rabbit polyclonal antibody

Size

POA

SKU:: A10806
Additional Names:: [KD Validated] MTMR3|FYVE-DSP1|ZFYVE10
Application:: ELISA, WB
Molecular Weight:: 130-150kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPGGAELSVAAGVAEGQMENILQEATKEESGVEEPAHRAGIEIQEGKEDPLLEKESRRKTPEASAIGLHQDPELGDAALRSHLDMSWPLFSQGISEQQSGLSVLLSSLQVPPRGEDSLEVPVEQFRIEEIAEGREEAVL
Uniprot:: Q13615
Synonyms:: FYVE (Fab1 YGLO23 Vsp27 EEA1 domain) dual-specificity protein phosphatase;FYVE domain-containing dual specificity protein phosphatase 1;FYVE-DSP1;myotubularin-related protein 3;phosphatidylinositol-3-phosphate phosphatase;phosphatidylinositol-3,5-bisphosphate 3-phosphatase;ZFYVE10;zinc finger FYVE domain-containing protein 10;zinc finger, FYVE domain containing 10
Extra Details:: This gene encodes a member of the myotubularin dual specificity protein phosphatase gene family. The encoded protein is structurally similar to myotubularin but in addition contains a FYVE domain and an N-terminal PH-GRAM domain. The protein can self-associate and also form heteromers with another myotubularin related protein. The protein binds to phosphoinositide lipids through the PH-GRAM domain, and can hydrolyze phosphatidylinositol(3)-phosphate and phosphatidylinositol(3,5)-biphosphate in vitro. The encoded protein has been observed to have a perinuclear, possibly membrane-bound, distribution in cells, but it has also been found free in the cytoplasm. Multiple transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice