PSMD14 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10782
Additional Names:: PAD1|POH1|PSMD14|RPN11
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 37kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: FRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
Uniprot:: O00487
Synonyms:: 26S proteasome non-ATPase regulatory subunit 14;26S proteasome regulatory subunit rpn11;26S proteasome-associated PAD1 homolog 1;PAD1;POH1;proteasome (prosome, macropain) 26S subunit, non-ATPase, 14;RPN11;testis tissue sperm-binding protein Li 69n
Extra Details:: This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S proteasome and mediates substrate deubiquitination. A pseudogene of this gene is also located on the long arm of chromosome 2.