slc25a43 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10726
Additional Names:: SLC25A43
Application:: ELISA, WB
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MATWRRDGRLTGGQRLLCAGLAGTLSLSLTAPLELATVLAQVGVVRGHARGPWATGHRVWRAEGLRALWKGNAVACLRLFPCSAVQLAAYRKFVVLFTDD
Uniprot:: Q8WUT9
Synonyms:: solute carrier family 25 member 43
Extra Details:: This gene encodes a member of the mitochondrial carrier family of proteins.