CSRP1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1071
Additional Names:: CRP|CRP1|CSRP|CSRP1|CYRP|D1S181E|HEL-141|HEL-S-286
Application:: ELISA, WB, IP
Molecular Weight:: 21kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKSCYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCPRCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGFGFGQGAGALVHSE
Uniprot:: P21291
Synonyms:: CRP;CRP1;CSRP;CYRP;cysteine and glycine-rich protein 1;cysteine-rich protein 1;D1S181E;epididymis luminal protein 141;epididymis secretory protein Li 286;epididymis secretory sperm binding protein;HEL-141;HEL-S-286;LIM-domain protein
Extra Details:: This gene encodes a member of the cysteine-rich protein (CSRP) family. This gene family includes a group of LIM domain proteins, which may be involved in regulatory processes important for development and cellular differentiation. The LIM/double zinc-finger motif found in this gene product occurs in proteins with critical functions in gene regulation, cell growth, and somatic differentiation. Alternatively spliced transcript variants have been described.