CYBA Rabbit polyclonal antibody

Size

£152.00

SKU:: A10694
Additional Names:: CGD4|CYBA|p22-PHOX
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 22kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: VRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV
Uniprot:: P13498
Synonyms:: CGD4;cytochrome b light chain;cytochrome b-245 light chain;cytochrome b-245, alpha polypeptide;cytochrome b, alpha polypeptide;cytochrome b(558) alpha chain;cytochrome b(558) alpha-subunit;cytochrome b558 subunit alpha;flavocytochrome b-558 alpha polypeptide;neutrophil cytochrome b 22 kDa polypeptide;p22 phagocyte B-cytochrome;p22-PHOX;p22phox;superoxide-generating NADPH oxidase light chain subunit
Extra Details:: Cytochrome b is comprised of a light chain (alpha) and a heavy chain (beta). This gene encodes the light, alpha subunit which has been proposed as a primary component of the microbicidal oxidase system of phagocytes. Mutations in this gene are associated with autosomal recessive chronic granulomatous disease (CGD), that is characterized by the failure of activated phagocytes to generate superoxide, which is important for the microbicidal activity of these cells.