CCL1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10670
Additional Names:: CCL1|I-309|P500|SCYA1|SISe|TCA3
Application:: ELISA, WB
Molecular Weight:: 14kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK
Uniprot:: P22362
Synonyms:: C-C motif chemokine 1;chemokine (C-C motif) ligand 1;I-309;inflammatory cytokine I-309;P500;SCYA1;SISe;small inducible cytokine A1 (I-309, homologous to mouse Tca-3);Small-inducible cytokine A1;T lymphocyte-secreted protein I-309;TCA3
Extra Details:: This antimicrobial gene is one of several chemokine genes clustered on the q-arm of chromosome 17. Chemokines form a superfamily of secreted proteins involved in immunoregulatory and inflammatory processes. The superfamily is divided into four subfamilies based on the arrangement of the N-terminal cysteine residues of the mature peptide. This chemokine, a member of the CC subfamily, is secreted by activated T cells and displays chemotactic activity for monocytes but not for neutrophils. It binds to the chemokine (C-C motif) receptor 8.