A1067
LYZL6 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1067
- Additional Names:
- HEL-S-6a|LYC1|LYZB|LYZL6|PRO1485|TKAL754|UNQ754
- Application:
- ELISA, WB
- Molecular Weight:
- 17kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR
- Uniprot:
- O75951
- Synonyms:
- epididymis secretory sperm binding protein Li 6a;HEL-S-6a;LYC1;lysozyme B;lysozyme homolog;lysozyme-like protein 6;LYZB;PRO1485;TKAL754;UNQ754
- Extra Details:
- This gene encodes a member of the C-type lysozyme/alpha-lactalbumin family. C-type lysozymes are bacteriolytic factors that play a role in host defense, whereas alpha-lactalbumins mediate lactose biosynthesis. The encoded protein contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Alternatively spliced transcript variants have been observed for this gene.
- Shipping Conditions:
- Blue Ice