A10669
AscL1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10669
- Additional Names:
- AscL1|ASH1|bHLHa46|HASH1|MASH1
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- ANKKMSKVETLRSAVEYIRALQQLLDEHDAVSAAFQAGVLSPTISPNYSNDLNSMAGSPVSSYSSDEGSYDPLSPEEQELLDFTNWF
- Uniprot:
- P50553
- Synonyms:
- achaete scute protein;achaete-scute complex homolog 1;achaete-scute complex-like 1;achaete-scute homolog 1;ASH-1;ASH1;bHLHa46;class A basic helix-loop-helix protein 46;HASH1;MASH1
- Extra Details:
- This gene encodes a member of the basic helix-loop-helix (BHLH) family of transcription factors. The protein activates transcription by binding to the E box (5'-CANNTG-3'). Dimerization with other BHLH proteins is required for efficient DNA binding. This protein plays a role in the neuronal commitment and differentiation and in the generation of olfactory and autonomic neurons. Mutations in this gene may contribute to the congenital central hypoventilation syndrome (CCHS) phenotype in rare cases.
- Shipping Conditions:
- Blue Ice

