A10658
SLC35A1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10658
- Additional Names:
- CDG2F|CMPST|CST|hCST|SLC35A1
- Application:
- ELISA, WB
- Molecular Weight:
- 33kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSVGILAKETGSLGRFKASLRENVLGSPKELLKLSVPSLVYAV
- Uniprot:
- P78382
- Synonyms:
- CDG2F;CMP-SA-Tr;CMP-Sia-Tr;CMP-sialic acid transporter;CMPST;CST;hCST;mutated CMP-sialic acid transporter A1;solute carrier family 35 (CMP-sialic acid transporter), member 1;solute carrier family 35 (CMP-sialic acid transporter), member A1;solute carrier family 35 (UDP-galactose transporter), member 1;Solute carrier family 35 member A1
- Extra Details:
- The protein encoded by this gene is found in the membrane of the Golgi apparatus, where it transports nucleotide sugars into the Golgi. One such nucleotide sugar is CMP-sialic acid, which is imported into the Golgi by the encoded protein and subsequently glycosylated. Defects in this gene are a cause of congenital disorder of glycosylation type 2F (CDG2F). Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice