TDGF1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A1065
Additional Names:: CR|CR-1|CRGF|CRIPTO|TDGF1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 18kDa/20kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPEL
Uniprot:: P13385
Synonyms:: CR;CR-1;CRGF;CRIPTO;cripto-1 growth factor;epidermal growth factor-like cripto protein CR1;teratocarcinoma-derived growth factor 1
Extra Details:: This gene encodes an epidermal growth factor-related protein that contains a cripto, FRL-1, and cryptic domain. The encoded protein is an extracellular, membrane-bound signaling protein that plays an essential role in embryonic development and tumor growth. Mutations in this gene are associated with forebrain defects. Pseudogenes of this gene are found on chromosomes 2, 3, 6, 8, 19 and X. Alternate splicing results in multiple transcript variants.