[KO Validated] RhoC Rabbit polyclonal antibody

Size

POA

SKU:: A1062
Additional Names:: ARH9|ARHC|H9|oC|RHOH9
Application:: ELISA, WB
Molecular Weight:: 22kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL
Uniprot:: P08134
Synonyms:: ARH9;ARHC;epididymis secretory sperm binding protein;H9;oncogene RHO H9;ras homolog gene family, member C;RAS-related homolog 9;rho cDNA clone 9;rho-related GTP-binding protein RhoC;rhoC GTPase;RHOH9;small GTP binding protein RhoC
Extra Details:: This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Shipping Conditions:: Blue Ice