Gsdma Rabbit polyclonal antibody

Size

£152.00

SKU:: A10602
Additional Names:: Gsdm|Gsdm1|Gsdma|Gsdma1|H312E
Application:: ELISA, WB
Molecular Weight:: 49kDa
Species Reactivity:: Mouse
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: ASDVGEMHEDFKTLKEEVQRETQEVEKLSPVGRSSLLTSLSHLLGKKKELQDLEQTLEGALDKGHEVTLEALPKDVLLSKDAMDAILYFLGALTVLSEAQ
Synonyms:: BB149167;FKSG9;gasdermin 1;gasdermin-1;gasdermin-A;gasdermin-A1;Gsd;Gsdm;Gsdm1;Gsdma1;H312E
Extra Details:: Predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity; phosphatidylinositol-4-phosphate binding activity; and phosphatidylserine binding activity. Predicted to be involved in apoptotic process; defense response to bacterium; and pyroptosis. Predicted to act upstream of or within programmed cell death. Located in cytoplasm. Is expressed in esophagus epithelium; stomach; stomach cardiac region; stomach glandular region; and stomach glandular region mucosa. Orthologous to human GSDMA (gasdermin A).