A10596
MARCH9 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10596
- Additional Names:
- MARCH-IX|MARCH9|RNF179
- Application:
- ELISA, WB
- Molecular Weight:
- 36kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- GTAGKSGPRNSRTGPTSGATSRPPAAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV
- Uniprot:
- Q86YJ5
- Synonyms:
- E3 ubiquitin-protein ligase MARCH9;E3 ubiquitin-protein ligase MARCHF9;MARCH-IX;MARCH9;membrane associated ring finger 9;membrane-associated ring finger (C3HC4) 9;membrane-associated RING finger protein 9;membrane-associated RING-CH protein IX;RING finger protein 179;RING-type E3 ubiquitin transferase MARCH9;RING-type E3 ubiquitin transferase MARCHF9;RNF179
- Extra Details:
- MARCH9 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH9 induces internalization of several membrane glycoproteins and directs them to the endosomal compartment (Bartee et al., 2004 [PubMed 14722266]; Hoer et al., 2007 [PubMed 17174307]).
- Shipping Conditions:
- Blue Ice

