A10588
C5AR2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10588
- Additional Names:
- C5AR2|C5L2|GPF77|GPR77
- Application:
- ELISA, WB
- Molecular Weight:
- 36kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- VAAPNSALLARALRAEPLIVGLALAHSCLNPMLFLYFGRAQLRRSLPAACHWALRESQGQDESVDSKKSTSHDLVSEMEV
- Uniprot:
- Q9P296
- Synonyms:
- C5a anaphylatoxin chemotactic receptor 2;C5a anaphylatoxin chemotactic receptor C5L2;C5L2;complement component 5a receptor 2;G protein-coupled receptor 77;G protein-coupled receptor C5L2;G-protein coupled receptor 77;GPF77;GPR77
- Extra Details:
- This gene encodes a G-protein coupled receptor 1 family member involved in the complement system of the innate immune response. Unlike classical G-protein coupled receptors, the encoded protein does not associate with intracellular G-proteins. It may instead modulate signal transduction through the beta-arrestin pathway, and may alternatively act as a decoy receptor. This gene may be involved in coronary artery disease and in the pathogenesis of sepsis. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice