A10581
KLF1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10581
- Additional Names:
- EKLF|EKLF/KLF1|KLF1
- Application:
- ELISA, WB
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MATAETALPSISTLTALGPFPDTQDDFLKWWRSEEAQDMGPGPPDPTEPPLHVKSEDQPGEEEDDERGADATWDLDLLLTNFSGPEPGGAPQTCALAPSE
- Uniprot:
- Q13351
- Synonyms:
- EKLF;EKLF/KLF1;erythroid krueppel-like transcription factor;erythroid Kruppel-like factor;erythroid-specific transcription factor EKLF;Krueppel-like factor 1;truncated erythroid Kruppel-like factor EKLF/KLF1;truncated Kruppel-like factor 1
- Extra Details:
- This gene encodes a hematopoietic-specific transcription factor that induces high-level expression of adult beta-globin and other erythroid genes. The zinc-finger protein binds to the DNA sequence CCACACCCT found in the beta hemoglobin promoter. Heterozygous loss-of-function mutations in this gene result in the dominant In(Lu) blood phenotype.
- Shipping Conditions:
- Blue Ice