SCN2A Rabbit polyclonal antibody

Size

£152.00

SKU:: A10574
Additional Names:: BFIC3|BFIS3|BFNIS|DEE11|EA9|EIEE11|HBA|HBSCI|HBSCII|Na(v)1.2|NAC2|Nav1.2|SCN2A|SCN2A1|SCN2A2
Application:: ELISA, WB
Molecular Weight:: 250kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RNKCLQWPPDNSSFEINITSFFNNSLDGNGTTFNRTVSIFNWDEYIEDKSHFYFLEGQNDALLCGNSSDAGQCPEGYICVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTY
Uniprot:: Q99250
Synonyms:: BFIC3;BFIS3;BFNIS;DEE11;EA9;EIEE11;HBA;HBSC II;HBSCI;HBSCII;Na(v)1.2;NAC2;Nav1.2;SCN2A1;SCN2A2;sodium channel protein brain II subunit alpha;sodium channel protein type 2 subunit alpha;sodium channel protein type II subunit alpha;sodium channel protein, brain type 2 alpha subunit;sodium channel, voltage-gated, type II, alpha 1 polypeptide;sodium channel, voltage-gated, type II, alpha 2 polypeptide;sodium channel, voltage-gated, type II, alpha subunit;voltage-gated sodium channel subtype II;voltage-gated sodium channel subunit alpha Nav1.2;voltage-gated sodium channel type II alpha subunit
Extra Details:: Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit with four repeat domains, each of which is composed of six membrane-spanning segments, and one or more regulatory beta subunits. Voltage-gated sodium channels function in the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel alpha subunit gene family. Allelic variants of this gene are associated with seizure disorders and autism spectrum disorder. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice