A1057
Slug Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1057
- Additional Names:
- SLUG|SLUGH|SLUGH1|SNAIL2|WS2D
- Application:
- ELISA, WB
- Molecular Weight:
- 30kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLH
- Uniprot:
- O43623
- Synonyms:
- neural crest transcription factor SLUG;protein snail homolog 2;SLUG;slug (chicken homolog), zinc finger protein;SLUGH;SLUGH1;snail family zinc finger 2;snail homolog 2;SNAIL2;WS2D;zinc finger protein SNAI2
- Extra Details:
- This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.
- Shipping Conditions:
- Blue Ice



