GNT-V/MGAT5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10567
Additional Names:: glcNAc-T V|GNT-V|GNT-V/MGAT5|GNT-VA|MGAT5A
Application:: ELISA, WB
Molecular Weight:: 100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: HGQVMWPPLSALQVKLAEPGQSCKQVCQESQLICEPSFFQHLNKDKDMLKYKVTCQSSELAKDILVPSFDPKNKHCVFQGDLLLFSCAGAHPRHQRVCPCRDFIKGQVALCKDCL
Uniprot:: Q09328
Synonyms:: alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A;Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase;alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase V;glcNAc-T V;GNT-V;GNT-VA;mannoside acetylglucosaminyltransferase 5;mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase;MGAT5A;N-acetylglucosaminyl-transferase V
Extra Details:: The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the activity of this enzyme has been correlated with the progression of invasive malignancies.

Shipping Conditions:: Blue Ice