A10559
COL11A1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10559
- Additional Names:
- CO11A1|COL11A1|COLL6|DFNA37|STL2
- Application:
- ELISA, WB, IHC-P
- Molecular Weight:
- 252kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EKKKSNFKKKMRTVATKSKEKSKKFTPPKSEKFSSKKKKSYQASAKAKLGVKANIVDDFQEYNYGTMESYQTEAPRHVSGTNEPNPVEEIFTEEYLTGEDYDSQRKNSEDTLYENKEIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPPNEEFGPGVPAETDITETSING
- Uniprot:
- P12107
- Synonyms:
- CO11A1;COLL6;collagen alpha-1(XI) chain;collagen XI, alpha-1 polypeptide;collagen, type XI, alpha 1;deafness, autosomal dominant 37;DFNA37;STL2
- Extra Details:
- This gene encodes one of the two alpha chains of type XI collagen, a minor fibrillar collagen. Type XI collagen is a heterotrimer but the third alpha chain is a post-translationally modified alpha 1 type II chain. Mutations in this gene are associated with type II Stickler syndrome and with Marshall syndrome. A single-nucleotide polymorphism in this gene is also associated with susceptibility to lumbar disc herniation. Multiple transcript variants have been identified for this gene.
- Shipping Conditions:
- Blue Ice