[KO Validated] HK1 Rabbit polyclonal antibody

Size

POA

SKU:: A1054
Additional Names:: hexokinase|HK|HK1-ta|HK1-tb|HK1-tc|HKD|HKI|HMSNR|HXK1|K1|NEDVIBA|NMSR|RP79
Application:: ELISA, WB, IHC-P, IF, ICC, IP
Molecular Weight:: 102kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGY
Uniprot:: P19367
Synonyms:: brain form hexokinase;glycolytic enzyme;hexokinase;hexokinase IR;hexokinase type I;hexokinase-1;hexokinase-A;HK;HK1-ta;HK1-tb;HK1-tc;HKD;HKI;HMSNR;HXK1;NEDVIBA;RP79
Extra Details:: Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in several transcript variants which encode different isoforms, some of which are tissue-specific.