DVL1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10536
Additional Names:: DRS2|DVL|DVL1|DVL1L1|DVL1P1
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: GQGYPYQYPGPPPCFPPAYQDPGFSYGSGSTGSQQSEGSKSSGSTRSSRRAPGREKERRAAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPPPHPTTKAYTVVGGPPGGPPVRE
Uniprot:: O14640
Synonyms:: dishevelled 1 (homologous to Drosophila dsh);dishevelled-1;dishevelled, dsh homolog 1;DRS2;DSH homolog 1;DVL;DVL1L1;DVL1P1;segment polarity protein dishevelled homolog DVL-1
Extra Details:: DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.