A10501
CSF2RB Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10501
- Additional Names:
- betaGMR|CD131|CDw131|CSF2RB|IL3RB|IL5RB|SMDP5
- Application:
- ELISA, WB
- Molecular Weight:
- 95-120kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- EHLMPSSTYVARVRTRLAPGSRLSGRPSKWSPEVCWDSQPGDEAQPQNLECFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREGLGSLHTRHHCQIPVPDPATHGQYIVSVQPRRAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWETMKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTSRTGYNGIWSEWSEARSWDTESVLPMW
- Uniprot:
- P32927
- Synonyms:
- beta common cytokine receptor;beta-GM-CSF receptor;betaGMR;CD131;CDw131;colony stimulating factor 2 receptor beta common subunit;colony stimulating factor 2 receptor, beta, low-affinity (granulocyte-macrophage);colony-stimulating factor-2 receptor, beta, low-affinity;cytokine receptor common subunit beta;GM-CSF/IL-3/IL-5 receptor common beta subunit;GM-CSF/IL-3/IL-5 receptor common beta-chain;IL3RB;IL5RB;interleukin 3 receptor/granulocyte-macrophage colony stimulating factor 3 receptor, beta (high affinity);SMDP5
- Extra Details:
- The protein encoded by this gene is the common beta chain of the high affinity receptor for IL-3, IL-5 and CSF. Defects in this gene have been reported to be associated with protein alveolar proteinosis (PAP).
- Shipping Conditions:
- Blue Ice