RASGRP1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10495
Additional Names:: CALDAG-GEFI|CALDAG-GEFII|IMD64|RASGRP|RASGRP1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 90kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: PVAPTENNTSVGPVSNLCSLGAKDLLHAPEEGPFTFPNGEAVEHGEESKDRTIMLMGVSSQKISLRLKRAVAHKATQTESQPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS
Uniprot:: O95267
Synonyms:: calcium and DAG-regulated guanine nucleotide exchange factor II;calcium- and diacylglycerol-regulated guanine nucleotide exchange factor II;CALDAG-GEFI;CALDAG-GEFII;guanine nucleotide exchange factor, calcium- and DAG-regulated, Rap1A;IMD64;ras activator RasGRP;RAS guanyl nucleotide-releasing protein 1;RAS guanyl releasing protein 1 (calcium and DAG-regulated);Ras guanyl-releasing protein;RAS guanyl-releasing protein 1;RASGRP
Extra Details:: This gene is a member of a family of genes characterized by the presence of a Ras superfamily guanine nucleotide exchange factor (GEF) domain. It functions as a diacylglycerol (DAG)-regulated nucleotide exchange factor specifically activating Ras through the exchange of bound GDP for GTP. It activates the Erk/MAP kinase cascade and regulates T-cells and B-cells development, homeostasis and differentiation. Alternatively spliced transcript variants encoding different isoforms have been identified. Altered expression of the different isoforms of this protein may be a cause of susceptibility to systemic lupus erythematosus (SLE).

Shipping Conditions:: Blue Ice