A10492
NFKBIZ Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A10492
- Additional Names:
- I-kappa-B-zeta|IkappaB-zeta|ikappaBzeta|ikB-zeta|IKBZ|INAP|MAIL|NFKBIZ
- Application:
- ELISA, WB
- Molecular Weight:
- 64kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MIVDKLLDDSRGGEGLRDAAGGCGLMTSPLNLSYFYGASPPAAAPGACDASCSVLGPSAPGSPGSDSSDFSSASSVSSCGAVESRSRGGARAERQPVEPHMGVGRQQRGPFQGVRVKNSVKELLLHIRSHKQKASGQAVDDFKTQGVNIEQFRELKNTVSYSGKRKGPDSLSDGPACKRPALLHSQFLTPPQTPTPGESMEDVHLNEPKQESSADLLQNI
- Uniprot:
- Q9BYH8
- Synonyms:
- I-kappa-B-zeta;Ikappa B-zeta variant 3;IkappaB-zeta;ikappaBzeta;ikB-zeta;IKBZ;IL-1 inducible nuclear ankyrin-repeat protein;INAP;MAIL;molecule possessing ankyrin repeats induced by lipopolysaccharide;NF-kappa-B inhibitor zeta;nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta
- Extra Details:
- This gene is a member of the ankyrin-repeat family and is induced by lipopolysaccharide (LPS). The C-terminal portion of the encoded product which contains the ankyrin repeats, shares high sequence similarity with the I kappa B family of proteins. The latter are known to play a role in inflammatory responses to LPS by their interaction with NF-B proteins through ankyrin-repeat domains. Studies in mouse indicate that this gene product is one of the nuclear I kappa B proteins and an activator of IL-6 production. Two transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice