PEX6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10459
Additional Names:: HMLR2|PAF-2|PAF2|PBD4A|PDB4B|PEX6|PXAAA1
Application:: ELISA, WB
Molecular Weight:: 104kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LLHGPPGTGKTLLAKAVATECSLTFLSVKGPELINMYVGQSEENVREVFARARAAAPCIIFFDELDSLAPSRGRSGDSGGVMDRVVSQLLAELDGLHSTQDVFVIGATNRPDLLDPALLRPGRFDKLVFVGANEDRASQLRVLSAITRKFKLEPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLEPGSSALMLTMEDLLQAAARLQPSVSEQELLRYKRIQRKFAAC
Uniprot:: Q13608
Synonyms:: HMLR2;PAF-2;PAF2;PBD4A;PDB4B;peroxin-6;peroxisomal AAA-type ATPase 1;Peroxisomal biogenesis factor 6;peroxisomal-type ATPase 1;peroxisome assembly factor 2;peroxisome biogenesis factor 6;PXAAA1
Extra Details:: This gene encodes a member of the AAA (ATPases associated with diverse cellular activities) family of ATPases. This member is a predominantly cytoplasmic protein, which plays a direct role in peroxisomal protein import and is required for PTS1 (peroxisomal targeting signal 1, a C-terminal tripeptide of the sequence ser-lys-leu) receptor activity. Mutations in this gene cause peroxisome biogenesis disorders of complementation group 4 and complementation group 6. Several transcript variants encoding different isoforms have been found for this gene.

Shipping Conditions:: Blue Ice