A10451
FCRL3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10451
- Additional Names:
- CD307c|FCRH3|FCRL3|IFGP3|IRTA3|MAIA|SPAP2
- Application:
- ELISA, WB
- Molecular Weight:
- 105kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- RRKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEE
- Uniprot:
- Q96P31
- Synonyms:
- CD307c;Fc receptor homolog 3;Fc receptor-like protein 3;fcR-like protein 3;FCRH3;hIFGP3;IFGP family protein 3;IFGP3;immune receptor translocation-associated protein 3;immunoglobulin superfamily receptor translocation associated protein 3;IRTA3;SH2 domain-containing phosphatase anchor protein 2;SPAP2
- Extra Details:
- This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain and may play a role in regulation of the immune system. Mutations in this gene have been associated with rheumatoid arthritis, autoimmune thyroid disease, and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

