SLC4A5 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10436
Additional Names:: NBC4|NBCe2|SLC4A5
Application:: ELISA, WB, IHC-P
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DFIFSQHDLAWIDNILPEKEKKETDKKRKRKKGAHEDCDEEPQFPPPSVIKIPMESVQSDPQNGIHCIARKRSSSWSYSL
Uniprot:: Q9BY07
Synonyms:: electrogenic sodium bicarbonate cotransporter 4;NBC4;NBCe2;solute carrier family 4 (sodium bicarbonate cotransporter), member 5;Solute carrier family 4 member 5
Extra Details:: This gene encodes a member of the sodium bicarbonate cotransporter (NBC) family, part of the bicarbonate transporter superfamily. Sodium bicarbonate cotransporters are involved in intracellular pH regulation and electroneural or electrogenic sodium bicarbonate transport. This protein is thought to be an integral membrane protein. Multiple transcript variants encoding different isoforms have been found for this gene, but the biological validity of some variants has not been determined.