SEMA4F Rabbit polyclonal antibody

Size

£152.00

SKU:: A10432
Additional Names:: M-SEMA|m-Sema-M|PRO2353|S4F|SEMA4F|SEMAM|SEMAW
Application:: ELISA, WB, IHC-P
Molecular Weight:: 83kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: RKTLQQRWTTFLKADLLCPGPEHGRASSVLQDVAVLRPELGAGTPIFYGIFSSQWEGATISAVCAFRPQDIRTVLNGPFRELKHDCNRGLPVVDNDVPQPRPGECITNNMKLRHFGSSLSLPDRVLTFIRDHPLMDRPVFP
Uniprot:: O95754
Synonyms:: M-SEMA;m-Sema-M;PRO2353;S4F;sema domain immunoglobulin domain transmembrane domain (TM) and short cytoplasmic domain (semaphorin) 4F;sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4F;SEMAM;semaphorin M;semaphorin-4F;Semaphorin-M;semaphorin-W;SEMAW
Extra Details:: This gene encodes a transmembrane class IV semaphorin family protein, which plays a role in neural development. This gene may be involved in neurogenesis in prostate cancer, the development of neurofibromas, and breast cancer tumorigenesis. Alternative splicing results in multiple transcript variants.