COLEC12 Rabbit polyclonal antibody

Size

£152.00

SKU:: A10422
Additional Names:: CLP1|COLEC12|NSR2|SCARA4|SRCL
Application:: ELISA, WB
Molecular Weight:: 110kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: KVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAA
Uniprot:: Q5KU26
Synonyms:: CLP1;collectin placenta protein 1;collectin sub-family member 12;collectin-12;hCL-P1;NSR2;nurse cell scavenger receptor 2;SCARA4;Scavenger receptor class A member 4;scavenger receptor class A, member 4;scavenger receptor with C-type lectin;SRCL
Extra Details:: This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor that displays several functions associated with host defense. It can bind to carbohydrate antigens on microorganisms, facilitating their recognition and removal. It also mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein by vascular endothelial cells.