A10422
COLEC12 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A10422
- Additional Names:
- CLP1|COLEC12|NSR2|SCARA4|SRCL
- Application:
- ELISA, WB
- Molecular Weight:
- 110kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- KVVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQQLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTNLQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKNDFQNLQQVFLQAKKDTDWLKEKVQSLQTLAA
- Uniprot:
- Q5KU26
- Synonyms:
- CLP1;collectin placenta protein 1;collectin sub-family member 12;collectin-12;hCL-P1;NSR2;nurse cell scavenger receptor 2;SCARA4;Scavenger receptor class A member 4;scavenger receptor class A, member 4;scavenger receptor with C-type lectin;SRCL
- Extra Details:
- This gene encodes a member of the C-lectin family, proteins that possess collagen-like sequences and carbohydrate recognition domains. This protein is a scavenger receptor that displays several functions associated with host defense. It can bind to carbohydrate antigens on microorganisms, facilitating their recognition and removal. It also mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein by vascular endothelial cells.
- Shipping Conditions:
- Blue Ice

