A1041
Exportin 2 (XPO2) Rabbit monoclonal antibody
Size
POA
- SKU:
- A1041
- Additional Names:
- CAS|CSE1|Exportin 2 (XPO2)|XPO2
- Application:
- ELISA, WB
- Molecular Weight:
- 105kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LIGLFELPEDDTIPDEEHFIDIEDTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHKLSTACPGRVPSMVSTSLNAEALQYLQGYLQAASVTLL
- Uniprot:
- P55060
- Synonyms:
- CAS;cellular apoptosis susceptibility protein;chromosome segregation 1-like protein;CSE1;CSE1 chromosome segregation 1-like;epididymis secretory sperm binding protein;exp2;exportin-2;importin-alpha re-exporter;XPO2
- Extra Details:
- CSE1L (Chromosome Segregation 1-Like) is located on 20q13.13, and encodes a 971-amino-acid protein. It associates with microtubules and mitotic spindles, and is also considered to have a role in tumor progression. The CSE1L protein includes a nuclear localization signal allowing for transport into the nucleus via the importin-alpha/beta heterodimer. In addition, CSE1L plays roles in cell proliferation and apoptosis.
- Shipping Conditions:
- Blue Ice